Antibodies

Jump to Filters
View as table Download
C10orf32 (BORCS7) Rabbit Polyclonal Antibody
TA333514

USD 375.00

5 Days

Rabbit Polyclonal Anti-C10orf32 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-C10orf32 Antibody is: synthetic peptide directed towards the C-terminal region of Human C10orf32. Synthetic peptide located within the following region: RNMVLQEDAILHSEDSLRKMAIITTHLQYQQEAIQKNVEQSSDLQDQLNH