Rabbit Polyclonal Anti-MEF2B Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-MEF2B antibody: synthetic peptide directed towards the N terminal of human MEF2B. Synthetic peptide located within the following region: MGRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNS |
Rabbit Polyclonal Anti-MEF2B Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-MEF2B antibody: synthetic peptide directed towards the middle region of human MEF2B. Synthetic peptide located within the following region: GLGPPCAGCPWPTAGPGRRSPGGTSPERSPGTARARGDPTSLQASSEKTQ |
Germany
Japan
United Kingdom
China