Antibodies

Jump to Filters
View as table Download
Plunc (BPIFA1) Rabbit Polyclonal Antibody
TA344133

USD 475.00

5 Days

Rabbit Polyclonal Anti-PLUNC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLUNC antibody: synthetic peptide directed towards the middle region of human PLUNC. Synthetic peptide located within the following region: GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASL
Plunc (BPIFA1) Rabbit Polyclonal Antibody
TA374053

USD 220.00

3 Weeks

BPIFA1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-256 of human BPIFA1 (NP_057667.1).
Modifications Unmodified