BRD8 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BRD8 |
BRD8 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BRD8 |
BRD8 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BRD8 |
Rabbit Polyclonal Anti-BRD8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BRD8 antibody: synthetic peptide directed towards the middle region of human BRD8. Synthetic peptide located within the following region: LRSQDLDEELGSTAAGEIVEADVAIGKGDETPLTNVKTEASPESMLSPSH |
BRD8 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BRD8 |
BRD8 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BRD8 |