Antibodies

View as table Download

BTBD6 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human BTBD6

Rabbit Polyclonal Anti-BTBD6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BTBD6 antibody: synthetic peptide directed towards the N terminal of human BTBD6. Synthetic peptide located within the following region: FVVGPPGATRTVPAHKYVLAVGSSVFYAMFYGDLAEVKSEIHIPDVEPAA

Rabbit Polyclonal Anti-BTBD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BTBD6 antibody: synthetic peptide directed towards the middle region of human BTBD6. Synthetic peptide located within the following region: GKAFNRCSHLTRHKKIHTAVKRYKCEECGKAFKRCSHLNEHKRVQRGEKS

Rabbit polyclonal anti-BTBD6 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from interf human BTBD6.

Rabbit Polyclonal Anti-BTBD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BTBD6 antibody: synthetic peptide directed towards the middle region of human BTBD6. Synthetic peptide located within the following region: ALRSEGFCEIDRQTLEIIVTREALNTKEAVVFEAVLNWAEAECKRQGLPI

BTBD6 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human BTBD6