Rabbit polyclonal antibody to BZW2 (basic leucine zipper and W2 domains 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 238 of BZW2 (Uniprot ID#Q9Y6E2) |
Rabbit Polyclonal Anti-BZW2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BZW2 Antibody is: synthetic peptide directed towards the N-terminal region of Human BZW2. Synthetic peptide located within the following region: LDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETI |
BZW2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human BZW2 |
BZW2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 190-300 of human BZW2 (NP_054757.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
