Rabbit Polyclonal Anti-BBS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BBS2 antibody: synthetic peptide directed towards the N terminal of human BBS2. Synthetic peptide located within the following region: GSDLFWTVTGDNVNSLALCDFDGDGKKELLVGSEDFDIRVFKEDEIVAEM |
Rabbit Polyclonal Anti-BBS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BBS2 antibody: synthetic peptide directed towards the middle region of human BBS2. Synthetic peptide located within the following region: RGYLPGTAEMRGNLMDTSAEQDLIRELSQKKQNLLLELRNYEENAKAELA |
BBS2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-96 of human BBS2 (NP_114091.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China