Antibodies

View as table Download

Rabbit Polyclonal Anti-BCL11B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BCL11B antibody: synthetic peptide directed towards the C terminal of human BCL11B. Synthetic peptide located within the following region: RHMKTHGQIGKEVYRCDICQMPFSVYSTLEKHMKKWHGEHLLTNDVKIEQ

Rabbit Polyclonal Anti-BCL11B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-BCL11B Antibody: synthetic peptide directed towards the middle region of human BCL11B. Synthetic peptide located within the following region: QASKLKRHMKTHMHKAGSLAGRSDDGLSAASSPEPGTSELAGEGLKAADG

Rat Monoclonal anti-Bcl11b Antibody

Applications IF, WB
Reactivities Human, Mouse, Zebrafish
Conjugation Unconjugated

CTIP2 (BCL11B) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 307-334 amino acids from the Central region of human BCL11B

BCL11B Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of human BCL11B

BCL11B Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of human BCL11B

BCL11B Antibody - N-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human BCL11B

Ctip2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Ctip2

Ctip2 Rabbit monoclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated