Antibodies

View as table Download

BCL2A1 (Center) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 63~92 amino acids from the Center region of human BCL2A1

Rabbit Polyclonal Bfl-1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Bfl-1 antibody was raised against a 14 amino acid peptide from near the amino terminus of human Bfl-1.

Rabbit Polyclonal Bfl-1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Bfl-1 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human Bfl-1.

Goat Anti-BCL2A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NVVSVDTART, from the internal region of the protein sequence according to NP_004040.1; NP_001108207.1.

Rabbit Polyclonal Anti-BCL2A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BCL2A1 antibody: synthetic peptide directed towards the C terminal of human BCL2A1. Synthetic peptide located within the following region: FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY

Carrier-free (BSA/glycerol-free) BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)

Applications WB
Reactivities Human
Conjugation Unconjugated

Anti-BCL2A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-175 amino acids of human BCL2-related protein A1

BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)

Applications WB
Reactivities Human
Conjugation Unconjugated

BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)

Applications WB
Reactivities Human
Conjugation Unconjugated