BCL2A1 (Center) rabbit polyclonal antibody, Purified
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 63~92 amino acids from the Center region of human BCL2A1 |
BCL2A1 (Center) rabbit polyclonal antibody, Purified
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 63~92 amino acids from the Center region of human BCL2A1 |
Rabbit Polyclonal Bfl-1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Bfl-1 antibody was raised against a 14 amino acid peptide from near the amino terminus of human Bfl-1. |
Rabbit Polyclonal Bfl-1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Bfl-1 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human Bfl-1. |
Goat Anti-BCL2A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NVVSVDTART, from the internal region of the protein sequence according to NP_004040.1; NP_001108207.1. |
Rabbit Polyclonal Anti-BCL2A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCL2A1 antibody: synthetic peptide directed towards the C terminal of human BCL2A1. Synthetic peptide located within the following region: FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY |
Carrier-free (BSA/glycerol-free) BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-BCL2A1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-175 amino acids of human BCL2-related protein A1 |
BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |