Antibodies

Jump to Filters
View as table Download
BDKRB2 Rabbit Polyclonal Antibody
TA321167

USD 345.00

In Stock

Anti-BDKRB2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 377-391 amino acids of human bradykinin receptor B2
BDKRB2 Rabbit Polyclonal Antibody
TA346209

USD 410.00

5 Days

Rabbit Polyclonal Anti-BDKRB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BDKRB2 antibody: synthetic peptide directed towards the N terminal of human BDKRB2. Synthetic peptide located within the following region: MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV
BDKRB2 Rabbit Polyclonal Antibody
TA328719

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-B2 Bradykinin Receptor

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide GKRFRKKSWEVYQG(C), corresponding to amino acid residues 336-349 of human BKRB2. Intracellular, C-terminus.
BDKRB2 Rabbit Polyclonal Antibody
TA321168

USD 345.00

4 Weeks

Anti-BDKRB2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 377-391 amino acids of human bradykinin receptor B2
BDKRB2 Rabbit Polyclonal Antibody
TA373985

USD 220.00

3 Weeks

BDKRB2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 302-391 of human BDKRB2 (NP_000614.1).
Modifications Unmodified