Antibodies

Jump to Filters
View as table Download
BEAN1 Rabbit Polyclonal Antibody
TA334073

USD 375.00

5 Days

Rabbit Polyclonal Anti-BEAN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-BEAN1 Antibody is: synthetic peptide directed towards the C-terminal region of Human BEAN1. Synthetic peptide located within the following region: TDAPPPYSLTDSCPTLDGTSDSGSGHSPGRHQQEQRTPAQGGLHTVSMDT