Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-Human BMP-7 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CHO cells derived Recombinant Human BMP-7 |
Rabbit Polyclonal Anti-Bmp7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-Bmp7 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MVAFFKATEVHLRSIRSTGGKQRSQNRSKTPKNQEALRMASVAENSSSDQ |
Rabbit Polyclonal Anti-BMP7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP7 antibody: synthetic peptide directed towards the N terminal of human BMP7. Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ |
BMP7 rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Highly pure (>95%) recombinant Human BMP-7 (Ala316-His431) derived from E. coli. |
BMP7 rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Highly pure (>95%) recombinant Human BMP-7 (Ala316-His431) derived from E. coli. |
Rabbit anti-BMP7 Polyclonal Antibody
| Applications | ELISA, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- BMP7