Antibodies

View as table Download

Rabbit Polyclonal Anti-PLUNC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLUNC antibody: synthetic peptide directed towards the middle region of human PLUNC. Synthetic peptide located within the following region: GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASL

BPIFA1 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified