Rabbit Polyclonal Anti-BPIFB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BPIFB3 antibody is: synthetic peptide directed towards the N-terminal region of Human BPIFB3. Synthetic peptide located within the following region: ELLETVGTLARIDKDELGKAIQNSLVGEPILQNVLGSVTAVNRGLLGSGG |
Rabbit Polyclonal Anti-BPIFB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BPIFB3 antibody is: synthetic peptide directed towards the C-terminal region of Human BPIFB3. Synthetic peptide located within the following region: IELDINPIVKSVAGDIIDFPKSRAPAKVPPKKDHTSQVMVPLYLFNTTFG |
Anti-BPIFB3 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 260-273 amino acids of Human BPI fold containing family B, member 3 |
Germany
Japan
United Kingdom
China
