Rabbit Polyclonal Anti-BRAP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BRAP antibody: synthetic peptide directed towards the middle region of human BRAP. Synthetic peptide located within the following region: YLETQQKINHLPAETRQEIQEGQINIAMASASSPASSGGSGKLPSRKGRS |
Mouse Monoclonal BRAP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal BRAP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
BRAP Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human BRAP |
BRAP Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human BRAP (NP_006759.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China