Rabbit Polyclonal Anti-BRAT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BRAT1 antibody is: synthetic peptide directed towards the C-terminal region of Human BRAT1. Synthetic peptide located within the following region: FDCDRPVAQKSCDLLLFLRDKIASYSSLREARGSPNTASAEATLPRWRAG |
BRAT1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human BAAT1 |
BRAT1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 652-821 of human BRAT1 (NP_689956.2). |
| Modifications | Unmodified |
BRAT1 Rabbit monoclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China