Rabbit Polyclonal Anti-BRD4 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BRD4 antibody: synthetic peptide directed towards the C terminal of human BRD4. Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS |
Rabbit Polyclonal Anti-Brd4 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Brd4 antibody is: synthetic peptide directed towards the N-terminal region of Rat Brd4. Synthetic peptide located within the following region: MSTESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQSANAASTNPPPPET |
Rabbit Polyclonal Anti-BRD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human BRD4 |
BRD4 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human BRD4 |
BRD4 Rabbit polyclonal Antibody
| Applications | ELISA, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Acetyl-BRD4-K332 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Modifications | Acetyl K332 |
BRD4 Rabbit polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
Phospho-BRD4-T204 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Phospho T204 |
Recombinant Anti-BRD4 (Clone RAB-C131)
| Applications | ChIP, ELISA, FC, IF |
| Reactivities | Human |
| Conjugation | His Tag |
Recombinant Anti-BRD4 (Clone RAB-C131)
| Applications | ChIP, ELISA, FC, IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques. |
Germany
Japan
United Kingdom
China
