Germany
Japan
United Kingdom
China
BRMS1L (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human BRMS1L |
Antibodies
View as table Download
Rabbit Polyclonal Anti-BRMS1L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BRMS1L antibody: synthetic peptide directed towards the C terminal of human BRMS1L. Synthetic peptide located within the following region: GQTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSKLYISQLQKGKYSI |
Rabbit Polyclonal Anti-BRMS1L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BRMS1L antibody: synthetic peptide directed towards the C terminal of human BRMS1L. Synthetic peptide located within the following region: LWNDELQSRKKRKDPFSPDKKKPVVVSGPYIVYMLQDLDILEDWTTIRKA |
Carrier-free (BSA/glycerol-free) BRMS1L mouse monoclonal antibody,clone OTI9A3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
BRMS1L rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human BRMS1L |
BRMS1L mouse monoclonal antibody,clone OTI9A3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
BRMS1L mouse monoclonal antibody,clone OTI9A3, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
BRMS1L mouse monoclonal antibody,clone OTI9A3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
BRMS1L mouse monoclonal antibody,clone OTI9A3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- BRMS1L