Antibodies

Jump to Filters
View as table Download
BTF3 (N-term) Rabbit Polyclonal Antibody
AP50403PU-N

USD 450.00

2 Weeks

BTF3 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human BTF3
BTF3 Rabbit Polyclonal Antibody
TA335185

USD 310.00

5 Days

Rabbit Polyclonal Anti-BTF3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BTF3 antibody: synthetic peptide directed towards the middle region of human BTF3. Synthetic peptide located within the following region: DSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN
BTF3 Rabbit Polyclonal Antibody
TA374105

USD 220.00

3 Weeks

BTF3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human BTF3 (NP_001198.2).
Modifications Unmodified
BTF3 Rabbit Monoclonal Antibody [Clone ID: R01-2B7]
TA383834

USD 380.00

4 Weeks

BTF3 Rabbit monoclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated