Antibodies

Jump to Filters
View as table Download
C11orf53 (C-term) Rabbit Polyclonal Antibody
AP50431PU-N

USD 450.00

2 Weeks

C11orf53 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 190-219 amino acids from the C-terminal region of human C11orf53
C11orf53 Rabbit Polyclonal Antibody
TA333364

USD 375.00

5 Days

Rabbit Polyclonal Anti-C11orf53 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-C11orf53 Antibody: synthetic peptide directed towards the middle region of human C11orf53. Synthetic peptide located within the following region: SIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFMTVSN