Rabbit Polyclonal Anti-C11orf54 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C11orf54 antibody: synthetic peptide directed towards the N terminal of human C11orf54. Synthetic peptide located within the following region: CPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKVYDLNKIAKEI |
Rabbit Polyclonal Anti-C11orf54 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C11orf54 antibody: synthetic peptide directed towards the C terminal of human C11orf54. Synthetic peptide located within the following region: PVFVSRDPGFDLRLEHTHFFSRHGEGGHYHYDTTPDIVEYLGYFLPAEFL |
C11orf54 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human C11orf54 |
Germany
Japan
United Kingdom
China
