Antibodies

View as table Download

Rabbit Polyclonal Anti-C12orf4 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C12orf4 antibody: synthetic peptide directed towards the middle region of human C12orf4. Synthetic peptide located within the following region: QELGKSLTDQDVNSLAAQHFESQQDLENKWSNELKQSTAIQKQEYQEWVI

Rabbit Polyclonal Anti-C12orf4 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C12orf4 antibody: synthetic peptide directed towards the N terminal of human C12orf4. Synthetic peptide located within the following region: EESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEPS