Rabbit Polyclonal Anti-C12orf56 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C12orf56 Antibody is: synthetic peptide directed towards the N-terminal region of Human C12orf56. Synthetic peptide located within the following region: KESPLRDQQESSTPSKDSTLCPRPGLKKLSLHGQGAFRPLPSPSRRSSQS |
Rabbit Polyclonal Anti-C12orf56 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C12orf56 Antibody is: synthetic peptide directed towards the N-terminal region of Human C12orf56. Synthetic peptide located within the following region: RDVVAIDLIDDYPEFLSSPDREISQHIRIIYSSTVLKKECKKSNSVRKFL |
Germany
Japan
United Kingdom
China