Antibodies

Jump to Filters
View as table Download
C19orf2 (URI1) Rabbit Polyclonal Antibody
TA314804

USD 345.00

In Stock

Rabbit polyclonal anti-RMP antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human RMP.
C19orf2 (URI1) Rabbit Polyclonal Antibody
TA339790

USD 375.00

5 Days

Rabbit Polyclonal Anti-URI1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C19orf2 antibody: synthetic peptide directed towards the middle region of human C19orf2. Synthetic peptide located within the following region: NGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCS