Antibodies

Jump to Filters
View as table Download
CTRP4 (C1QTNF4) Rabbit Polyclonal Antibody
TA306234

USD 430.00

5 Days

Rabbit Polyclonal CTRP4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CTRP4 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human CTRP4.
CTRP4 (C1QTNF4) Rabbit Polyclonal Antibody
TA306235

USD 430.00

5 Days

Rabbit Polyclonal CTRP4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CTRP4 antibody was raised against a 16 amino acid peptide from near the center of human CTRP4.
CTRP4 (C1QTNF4) Rabbit Polyclonal Antibody
TA340207

USD 375.00

5 Days

Rabbit Polyclonal Anti-C1QTNF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1QTNF4 antibody: synthetic peptide directed towards the middle region of human C1QTNF4. Synthetic peptide located within the following region: DEQRRPGARRAASQSAMLQLDYGDTVWLRLHGAPQYALGAPGATFSGYLV
CTRP4 (C1QTNF4) Rabbit Polyclonal Antibody
TA340208

USD 375.00

5 Days

Rabbit Polyclonal Anti-C1QTNF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1QTNF4 antibody: synthetic peptide directed towards the middle region of human C1QTNF4. Synthetic peptide located within the following region: RRGDAVWLLSHDHDGYGAYSNHGKYITFSGFLVYPDLAPAAPPGLGASEL
CTRP4 (C1QTNF4) Rabbit Polyclonal Antibody
TA374139

USD 220.00

3 Weeks

C1QTNF4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 250-329 of human C1QTNF4 (NP_114115.2).
Modifications Unmodified