Antibodies

Jump to Filters
View as table Download
C1orf210 Rabbit Polyclonal Antibody
TA334787

USD 375.00

5 Days

Rabbit Polyclonal Anti-C1orf210 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1orf210 antibody is: synthetic peptide directed towards the middle region of Human C1orf210. Synthetic peptide located within the following region: VVLSLLIALAAKCHLCRRYHASYRHRPLPETGRGGRPQVAEDEDDDGFIE