Rabbit Polyclonal Anti-C21orf91 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C21orf91 antibody: synthetic peptide directed towards the middle region of human C21orf91. Synthetic peptide located within the following region: QGCPRSKLSKSTYEEVKTILSKKINWIVQYAQNKDLDSDSECSKNPQHHL |
Rabbit Polyclonal Anti-C21orf91 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C21orf91 antibody: synthetic peptide directed towards the middle region of human C21orf91. Synthetic peptide located within the following region: LCRNSVLWPHSHNQAQKKEETISSPEANVQTQHPHYSREELNSMTLGEVE |
Germany
Japan
United Kingdom
China