Rabbit Polyclonal Anti-C3orf62 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C3orf62 Antibody: synthetic peptide directed towards the middle region of human C3orf62. Synthetic peptide located within the following region: IDHTSIRTIEELAGKIEFENELNHMCGHCQDSPFKEEAWALLMDKSPQKA |
Carrier-free (BSA/glycerol-free) C3orf62 mouse monoclonal antibody,clone OTI9F5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
C3orf62 mouse monoclonal antibody,clone OTI9F5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
C3orf62 mouse monoclonal antibody,clone OTI9F5, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
C3orf62 mouse monoclonal antibody,clone OTI9F5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
C3orf62 mouse monoclonal antibody,clone OTI9F5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China