Antibodies

View as table Download

Rabbit Polyclonal Anti-C4B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C4B antibody: synthetic peptide directed towards the N terminal of human C4B. Synthetic peptide located within the following region: QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM

Complement C4B Chicken Polyclonal Antibody

Applications IHC
Reactivities Human
Immunogen Complement C4B antibody was raised against purified human complement C4b.

Carrier-free (BSA/glycerol-free) C4B mouse monoclonal antibody,clone OTI1B2

Applications WB
Reactivities Human
Conjugation Unconjugated

C4B mouse monoclonal antibody,clone OTI1B2

Applications WB
Reactivities Human
Conjugation Unconjugated

C4B mouse monoclonal antibody,clone OTI1B2

Applications WB
Reactivities Human
Conjugation Unconjugated