Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-C4BPA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C4BPA antibody: synthetic peptide directed towards the middle region of human C4BPA. Synthetic peptide located within the following region: QVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL |
C4BPA mouse monoclonal antibody, clone 10-07, Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
C4BPA rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human C4BPA |
C4BPA Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human C4BPA (NP_000706.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- C4BPA