Germany
Japan
United Kingdom
China
C4orf46 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 91-113 amino acids from the C-terminal region of human C4orf46 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-C4orf46 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C4orf46 antibody: synthetic peptide directed towards the middle region of human LOC201725. Synthetic peptide located within the following region: VSLGWPVPSRSSGPTVDQLEEVELQIGDAAFSLTKLLEATSAVSAQVEEL |
C4orf46 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
C4orf46 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Active filters
Target Symbol
- C4ORF46