C5R1 (C5AR1) mouse monoclonal antibody, clone 3H1738, Purified
| Applications | FC, FN, IHC, NEUT |
| Reactivities | Human, Rabbit |
C5R1 (C5AR1) mouse monoclonal antibody, clone 3H1738, Purified
| Applications | FC, FN, IHC, NEUT |
| Reactivities | Human, Rabbit |
C5R1 (C5AR1) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human C5AR1 |
Rabbit Polyclonal Anti-C5a Anaphylatoxin Receptor (extracellular)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)DKDTLDLNTPVDK, corresponding to amino acid residues 16-28 of human C5aR (Accession P21730 ). Extracellular, N-terminus. |
Rabbit Polyclonal Anti-C5AR1 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | C5AR1 / CD88 / C5a Receptor antibody was raised against synthetic 18 amino acid peptide from internal region of human C5AR1 / CD88. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Monkey (100%); Gibbon (89%). |
C5R1 (C5AR1) rat monoclonal antibody, clone 8D6, Biotin
| Applications | FC |
| Reactivities | Human |
| Conjugation | Biotin |
C5R1 (C5AR1) rat monoclonal antibody, clone 8D6, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
C5R1 (C5AR1) rat monoclonal antibody, clone 8D6, Purified
| Applications | FC |
| Reactivities | Human |
C5R1 (C5AR1) rat monoclonal antibody, clone 8D6, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
Rabbit Polyclonal Anti-C5AR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C5AR1 antibody: synthetic peptide directed towards the C terminal of human C5AR1. Synthetic peptide located within the following region: SHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKTLK |
C5AR1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human C5AR1 |
C5AR1 Rabbit polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
Recombinant Anti-C5aR (Clone S5/1)
| Applications | Bl, ELISA, FC, IP, WB |
| Reactivities | Ferret, Human, Rabbit, Cow |
| Conjugation | Unconjugated |
Recombinant Anti-C5aR (Clone S5/1)
| Applications | Bl, ELISA, FC, IP, WB |
| Reactivities | Ferret, Human, Rabbit, Cow |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-C5aR (Clone 32-G1)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-C5aR (Clone 32-G1)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |