Antibodies

Jump to Filters
View as table Download
C6orf58 (Center) Rabbit Polyclonal Antibody
AP50659PU-N

USD 450.00

2 Weeks

C6orf58 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 212-241 amino acids from the Central region of human C6orf58
C6orf58 Rabbit Polyclonal Antibody
TA330846

USD 375.00

5 Days

Rabbit Polyclonal Anti-C6orf58 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-C6orf58 antibody is: synthetic peptide directed towards the N-terminal region of Human C6orf58. Synthetic peptide located within the following region: ILWGLPLQYGWQYRTGRLADPTRRTNCGYESGDHMCISVDSWWADLNYFL