C6orf58 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 212-241 amino acids from the Central region of human C6orf58 |
C6orf58 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 212-241 amino acids from the Central region of human C6orf58 |
Rabbit Polyclonal Anti-C6orf58 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-C6orf58 antibody is: synthetic peptide directed towards the N-terminal region of Human C6orf58. Synthetic peptide located within the following region: ILWGLPLQYGWQYRTGRLADPTRRTNCGYESGDHMCISVDSWWADLNYFL |