Antibodies

Jump to Filters
View as table Download
C9orf116 Rabbit Polyclonal Antibody
TA320108

USD 430.00

5 Days

Rabbit Polyclonal PIERCE1 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen PIERCE1 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human PIERCE1.
C9orf116 Rabbit Polyclonal Antibody
TA334124

USD 375.00

5 Days

Rabbit Polyclonal Anti-C9orf116 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-C9orf116 Antibody is: synthetic peptide directed towards the N-terminal region of Human C9orf116. Synthetic peptide located within the following region: NNPGWFRGYRTQKAVSVYRTSNQAYGSRAPTVHEMPKVFYPNSNKFSQQL
C9orf116 Rabbit Polyclonal Antibody
TA365921

USD 380.00

4 Weeks

C9orf116 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human C9orf116
C9orf116 Rabbit Polyclonal Antibody
TA370272

USD 380.00

4 Weeks

C9orf116 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human C9orf116