Antibodies

Jump to Filters
View as table Download
C9orf43 Rabbit Polyclonal Antibody
TA330927

USD 375.00

5 Days

Rabbit polyclonal Anti-C9orf43 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C9orf43 antibody: synthetic peptide directed towards the middle region of human C9orf43. Synthetic peptide located within the following region: PEAQAARQKKISFNFSEIMASTGWNSELKLLRILQDTDDEDEEDQSSGAE
C9orf43 Mouse Monoclonal Antibody [Clone ID: OTI4F9]
CF810854

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) C9orf43 mouse monoclonal antibody,clone OTI4F9

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
C9orf43 Mouse Monoclonal Antibody [Clone ID: OTI2G6]
CF810895

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) C9orf43 mouse monoclonal antibody,clone OTI2G6

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
C9orf43 Mouse Monoclonal Antibody [Clone ID: OTI4F9]
TA810854

USD 379.00

In Stock

C9orf43 mouse monoclonal antibody,clone OTI4F9

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
C9orf43 Mouse Monoclonal Antibody [Clone ID: OTI4F9]
TA810854S

USD 159.00

2 Days

C9orf43 mouse monoclonal antibody,clone OTI4F9

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
C9orf43 Mouse Monoclonal Antibody [Clone ID: OTI2G6]
TA810895

USD 379.00

In Stock

C9orf43 mouse monoclonal antibody,clone OTI2G6

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
C9orf43 Mouse Monoclonal Antibody [Clone ID: OTI2G6]
TA810895S

USD 159.00

2 Days

C9orf43 mouse monoclonal antibody,clone OTI2G6

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated