Antibodies

View as table Download

CA2 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carbonic Anhydrase II (CA2) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 201-250 of Human CA II.

Rabbit polyclonal CA2 Antibody (N-term)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This CA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 54-83 amino acids from the N-terminal region of human CA2.

Rabbit polyclonal CA2 Antibody (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 209-238 amino acids from the C-terminal region of human CA2.

Rabbit Polyclonal Anti-CA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CA2 antibody: synthetic peptide directed towards the C terminal of human CA2. Synthetic peptide located within the following region: FGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFD

Rabbit Polyclonal Anti-CA2 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CA2 antibody: synthetic peptide directed towards the N terminal of human CA2. Synthetic peptide located within the following region: SQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVH

Anti-CA2 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-CA2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein