Germany
Japan
United Kingdom
China
CA2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CA2 |
Antibodies
View as table Download
Rabbit polyclonal CA2 Antibody (N-term)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 54-83 amino acids from the N-terminal region of human CA2. |
Rabbit polyclonal CA2 Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 209-238 amino acids from the C-terminal region of human CA2. |
Rabbit Polyclonal Anti-CA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CA2 antibody: synthetic peptide directed towards the C terminal of human CA2. Synthetic peptide located within the following region: FGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFD |
Rabbit Polyclonal Anti-CA2 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CA2 antibody: synthetic peptide directed towards the N terminal of human CA2. Synthetic peptide located within the following region: SQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVH |
Anti-CA2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-CA2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Active filters
Target Symbol
- CA2