Antibodies

View as table Download

Rabbit Polyclonal CLPH Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen CLPH antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human CLPH.

Rabbit Polyclonal Anti-CABS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CABS1 Antibody is: synthetic peptide directed towards the N-terminal region of Human CABS1. Synthetic peptide located within the following region: TTITSEGDHVTSVNEYMLESDFSTTTDNKLTAKKEKLKSEDDMGTDFIKS