Antibodies

Jump to Filters
View as table Download
CABS1 Rabbit Polyclonal Antibody
TA306879

USD 430.00

5 Days

Rabbit Polyclonal CLPH Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen CLPH antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human CLPH.
CABS1 Rabbit Polyclonal Antibody
TA331685

USD 375.00

5 Days

Rabbit Polyclonal Anti-CABS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CABS1 Antibody is: synthetic peptide directed towards the N-terminal region of Human CABS1. Synthetic peptide located within the following region: TTITSEGDHVTSVNEYMLESDFSTTTDNKLTAKKEKLKSEDDMGTDFIKS