Antibodies

Jump to Filters
View as table Download
CACNA1I Rabbit Polyclonal Antibody
TA338596

USD 375.00

5 Days

Rabbit Polyclonal Anti-CACNA1I Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNA1I antibody: synthetic peptide directed towards the middle region of human CACNA1I. Synthetic peptide located within the following region: LRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAS
Cacna1i Rabbit Polyclonal Antibody
TA328728

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-CaV3.3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide CNGRMPNIAKDVFTK, corresponding to amino acid residues 1053-1067 of rat Cav3.3. Intracellular, between domains II and III.