Antibodies

Jump to Filters
View as table Download
CACNA2D1 (N-term) Rabbit Polyclonal Antibody
AP17917PU-N

USD 450.00

2 Weeks

CACNA2D1 (N-term) rabbit polyclonal antibody

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human CACNA2D1
CACNA2D1 Rabbit Polyclonal Antibody
TA338373

USD 375.00

5 Days

Rabbit Polyclonal Anti-CACNA2D1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNA2D1 antibody: synthetic peptide directed towards the middle region of human CACNA2D1. Synthetic peptide located within the following region: PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI
CACNA2D1 Goat Polyclonal Antibody
TA303244

USD 375.00

5 Days

Goat Polyclonal Antibody against CACNA2D1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QEIFNKYNKDKKVR, from the internal region of the protein sequence according to NP_000713.2.
CACNA2D1 Rabbit Polyclonal Antibody
TA374189

USD 220.00

3 Weeks

CACNA2D1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 550-800 of human CACNA2D1 (NP_000713.2).
Modifications Unmodified