Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CALB1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Tadpole |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CALB1 antibody: synthetic peptide directed towards the C terminal of human CALB1. Synthetic peptide located within the following region: EFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIM |
Anti-Calbindin Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CALB1 mouse monoclonal antibody, clone CB-D7, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Rat |
Rabbit polyclonal CALB1 Antibody (Center)
| Applications | WB |
| Reactivities | Human, Rat (Predicted: Mouse, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This CALB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 90-116 amino acids from the Central region of human CALB1. |
Rabbit Polyclonal Anti-CALB1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CALB1 |
CALB1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human CALB1 |
CALB1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CALB1 |
CALB1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CALB1 |
Calbindin Rabbit polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
Calbindin Rabbit polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
Calbindin Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Calbindin |
Active filters
Target Symbol
- CALB1