Calneuron-1 / CALN1 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Calneuron-1 / CALN1 antibody was raised against a 16 amino acid peptide near the amino terminus of human CaBP8. |
Rabbit Polyclonal CaBP8 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CaBP8 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human CaBP8. |
Rabbit Polyclonal Anti-CALN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CALN1 antibody is: synthetic peptide directed towards the N-terminal region of Human CALN1. Synthetic peptide located within the following region: PGEGKPENEKKGDGGALGGGEEPPRSQAPDFPTWEKMPFHHVTAGLLYKG |
CALN1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China