Antibodies

Jump to Filters
View as table Download
Calcyon (CALY) Rabbit Polyclonal Antibody
TA341984

USD 375.00

5 Days

Rabbit Polyclonal Anti-Caly Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Caly antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RHRSILAAIGAYPLSRKHGTEMPAIWGNSYRAGKEEHKGTTPAAMTVSTA
Calcyon (CALY) Rabbit Polyclonal Antibody
TA374227

USD 220.00

3 Weeks

CALY Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human CALY (NP_056537.1).
Modifications Unmodified