Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal CaMK4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CaMK4 |
Rabbit Polyclonal CaMK4 (Thr196/200) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CaMK4 around the phosphorylation site of Threonine 196/200 |
| Modifications | Phospho-specific |
Rabbit polyclonal CaM Kinase IV antibody
| Applications | IHC, WB |
| Reactivities | Bovine, Chimpanzee, Human, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | This antiserum was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 305-323 of Human CaM Kinase IV protein. |
Rabbit Polyclonal Anti-CAMK4 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-CAMK4 antibody: synthetic peptide directed towards the C terminal of mouse CAMK4. Synthetic peptide located within the following region: VKAVVASSRLGSASSSHTSIQENHKASSDPPSTQDAKDSTDLLGKKMQEE |
Rabbit Polyclonal Anti-Camk4 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for Anti-Camk4 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Camk4. Synthetic peptide located within the following region: DSTDLLGKKMQEEDQEEDQVEAEASADEMRKLQSEEVEKDAGVKEEETSS |
Rabbit anti CaM Kinase IV Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide from aa 457-474 of rat CaM Kinase IV. |
CAMK4 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CAMK4 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CAMK4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CAMK4 |
CAMK4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CAMK4 |
CAMK4 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- CAMK4