Antibodies

Jump to Filters
View as table Download
CAMKK2 Rabbit Polyclonal Antibody
TA308424

USD 415.00

2 Weeks

Rabbit polyclonal antibody to CaMKK beta (calcium/calmodulin-dependent protein kinase kinase 2, beta)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 498 of CaMKK beta
CAMKK2 Rabbit Polyclonal Antibody
TA315087

USD 345.00

4 Weeks

Rabbit polyclonal anti-CAMKK2 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CAMKK2.
CAMKK2 Rabbit Polyclonal Antibody
TA371761

USD 380.00

4 Weeks

CAMKK2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CAMKK2
CAMKK2 Rabbit Polyclonal Antibody
TA337830

USD 375.00

5 Days

Rabbit Polyclonal Anti-CAMKK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAMKK2 antibody: synthetic peptide directed towards the N terminal of human CAMKK2. Synthetic peptide located within the following region: GGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGM
CAMKK2 Rabbit Polyclonal Antibody
TA361354

USD 360.00

5 Days

CAMKK2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CAMKK2
CAMKK2 Rabbit Polyclonal Antibody
TA361979

USD 360.00

5 Days

CAMKK2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CAMKK2
CAMKK2 Rabbit Polyclonal Antibody
TA367538

USD 380.00

4 Weeks

CAMKK2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CAMKK2