Antibodies

View as table Download

Rabbit anti-CAPN1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CAPN1

Rabbit Polyclonal Anti-CAPN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAPN1 antibody: synthetic peptide directed towards the middle region of human CAPN1. Synthetic peptide located within the following region: EVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLE

Rabbit polyclonal anti-Calpain 1 antibody

Applications WB
Reactivities Bovine, Human, Mouse, Rabbit, Rat, Pig
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 700 of rat Calpain 1

Rabbit Polyclonal Anti-CAPN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAPN1 antibody: synthetic peptide directed towards the N terminal of human CAPN1. Synthetic peptide located within the following region: EFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDL

Anti-CAPN1 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 543-713 amino acids of Human Calpain-1 catalytic subunit

Anti-CAPN1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 543-713 amino acids of Human Calpain-1 catalytic subunit

CAPN1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CAPN1

Calpain 1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-330 of human Calpain 1 (NP_005177.2).
Modifications Unmodified