Antibodies

Jump to Filters
View as table Download
Caveolin 3 (CAV3) Goat Polyclonal Antibody
TA305791

USD 375.00

In Stock

Goat Anti-CAV3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Pig
Conjugation Unconjugated
Immunogen Peptide with sequence EHTDLEAQIVKDIH-C, from the N Terminus of the protein sequence according to NP_203123.1.
Caveolin 3 (CAV3) Rabbit Polyclonal Antibody
TA330403

USD 375.00

5 Days

Rabbit Polyclonal Anti-CAV3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAV3 antibody: synthetic peptide directed towards the N terminal of human CAV3. Synthetic peptide located within the following region: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVG
Caveolin 3 (CAV3) (N-term) Rabbit Polyclonal Antibody
AP17187PU-N

USD 512.00

2 Weeks

Caveolin 3 (CAV3) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human CAV3
Caveolin 3 (CAV3) Rabbit Polyclonal Antibody
TA350952

USD 345.00

In Stock

Rabbit Polyclonal Anti-CAV3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CAV3
CAV3 Rabbit Polyclonal Antibody
TA366954

USD 380.00

4 Weeks

CAV3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CAV3
Caveolin 3 (CAV3) Rabbit Polyclonal Antibody
TA374311

USD 410.00

3 Weeks

Caveolin-3 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified