Germany
Japan
United Kingdom
China
Antibodies
View as table Download
CBLN1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CBLN1 |
Rabbit polyclonal anti-CBLN1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CBLN1. |
Rabbit Polyclonal Anti-CBLN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CBLN1 antibody: synthetic peptide directed towards the C terminal of human CBLN1. Synthetic peptide located within the following region: LMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGW |
CBLN1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CBLN1 |
Active filters
Target Symbol
- CBLN1