Antibodies

Jump to Filters
View as table Download
CBS Rabbit Polyclonal Antibody
TA308071

USD 415.00

In Stock

Rabbit Polyclonal antibody to CBS (cystathionine-beta-synthase)

Applications IF, IHC, IP, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 39 and 251 of CBS (Uniprot ID#P35520)
CBS Rabbit Polyclonal Antibody
TA327044

USD 275.00

3 Weeks

Rabbit anti-CBS Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CBS
CBS Rabbit Polyclonal Antibody
TA338394

USD 310.00

5 Days

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE
CBSL Mouse Monoclonal Antibody [Clone ID: 3E1]
AM31730PU-N

USD 480.00

2 Weeks

CBSL mouse monoclonal antibody, clone 3E1, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human, Rat
CBSL Mouse Monoclonal Antibody [Clone ID: 6B8]
AM31731PU-N

USD 480.00

2 Weeks

CBSL mouse monoclonal antibody, clone 6B8, Purified

Applications ELISA, IHC, WB
Reactivities Human
CBSL Mouse Monoclonal Antibody [Clone ID: 6A9]
AM31732PU-N

USD 480.00

2 Weeks

CBSL mouse monoclonal antibody, clone 6A9, Purified

Applications ELISA, IHC, WB
Reactivities Human
CBSL Mouse Monoclonal Antibody [Clone ID: 5F7]
AM31733PU-N

USD 480.00

2 Weeks

CBSL mouse monoclonal antibody, clone 5F7, Purified

Applications ELISA, IHC, WB
Reactivities Human
CBSL Rabbit Polyclonal Antibody
AP17189PU-N

USD 450.00

2 Weeks

CBSL rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human CBS
CBS Rabbit Polyclonal Antibody
TA349577

USD 345.00

In Stock

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CBS