Rabbit Polyclonal Anti-CBX2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CBX2 antibody: synthetic peptide directed towards the middle region of human CBX2. Synthetic peptide located within the following region: SDSDPDSASPPSTGQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVT |
CBX2 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human CBX2 |
Rabbit Polyclonal Anti-CBX2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CBX2 antibody: synthetic peptide directed towards the N terminal of human CBX2. Synthetic peptide located within the following region: SSSSSSSTSSSSSSDEEDDSDLDAKRGPRGRETHPVPQKKAQILVAKPEL |
Anti-CBX2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
CBX2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 62-211 of human CBX2 (NP_116036.1). |
| Modifications | Unmodified |
Recombinant Anti-CBX2 (Clone RAB-C238)
| Applications | ChIP, ELISA, IF |
| Reactivities | Human |
| Conjugation | His Tag |
Recombinant Anti-CBX2 (Clone RAB-C238)
| Applications | ChIP, ELISA, IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques. |
Germany
Japan
United Kingdom
China
